PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G341600.1.p
Common NameGLYMA_13G341600, LOC100805273
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family FAR1
Protein Properties Length: 744aa    MW: 85228.3 Da    PI: 6.7906
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G341600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR186.34.8e-2729114291
                 FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                          fY+eYAk++GF + k +s++s+ ++e+++++f C ++g++++++++     ++r++ ++gCka+++vk+++dgkw+v+++++eHnHel p
  Glyma.13G341600.1.p  29 FYKEYAKSAGFGTAKLSSRRSRASKEFIDAKFSCIRYGNKQQSDDA----INPRPSPKIGCKASMHVKRRQDGKWYVYSFVKEHNHELLP 114
                          9***************************************999877....9************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.0E-2429114IPR004330FAR1 DNA binding domain
PfamPF105514.3E-28227319IPR018289MULE transposase domain
PROSITE profilePS5096610.373506542IPR007527Zinc finger, SWIM-type
PfamPF044341.3E-7512540IPR007527Zinc finger, SWIM-type
SMARTSM005751.1E-7517544IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009585Biological Processred, far-red light phototransduction
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 744 aa     Download sequence    Send to blast
MDSSAVVGST ISEPHSDMEF ESHEAAYAFY KEYAKSAGFG TAKLSSRRSR ASKEFIDAKF  60
SCIRYGNKQQ SDDAINPRPS PKIGCKASMH VKRRQDGKWY VYSFVKEHNH ELLPAQAHFF  120
RSHRSSDPLS NDVRMRRRKN SNAVSKLFTA YQNVDCLENF VKHQHDKGRS LVLEAGHAHL  180
LLELFMHMQE ENPKFFYAVD LNEEHRLRNV FWVDAKGLED FTYFSDVVSF DTTYFTSKYK  240
IPLVMFIGVN HHIQPTLLGC ALIADETIYT FAWLLQTWLI AMGERAPQVL LTDQNEAIKA  300
AVAAFLPGTR HCFCLWHILE MIPKQLEFFG AWHDSFLEKF NNCIYKSWTE EQFDKKWWEL  360
VDDFNLRDVD WVQSLYDDRT CWAPTFMKDI SFAGLSTSSR SESLNSLFDN YIQIDTSLRA  420
FIEQYRMILE DRHEEEAKAN FDAWHETPDL KSPSPFEKQM LSVYTHEIFR KFQVEVLGAA  480
ACHLKKENDG VTSAYTVKDF ENNQNYMVEW NTSTSDICCS CHLFEYKGYL CRHAIVVLQM  540
SGVFSIPPKY ILQRWTNAAM SRHPIGEKLE EVQSKVRRFN DLCRRAIILG EEGSLSQESY  600
YMALGAISEA LKQCANLNNS VENGMRPDAS STHVVCNVEE EYHSIITSKN KVPDPKPNTG  660
KKAVRSGMAG RSLGSVENSE GNKGKVSQVE VGSGKDGFQQ MELTDPRSHN VMPMQFHSVV  720
PALFHNVSSP FHTAPSTHLH ENR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.213980.0cotyledon| root| seed coat
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006595046.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 4-like isoform X1
SwissprotQ6NQJ70.0FRS4_ARATH; Protein FAR1-RELATED SEQUENCE 4
TrEMBLI1M5270.0I1M527_SOYBN; Uncharacterized protein
STRINGGLYMA13G41660.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76320.10.0FAR1-related sequence 4